PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g005830.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 926aa    MW: 102826 Da    PI: 8.7633
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g005830.2genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.19.6e-0662118157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++  + L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ +k
  Csa02g005830.2  62 KRPRDLLNPKAAKYLQAVFAVKDAISKRESREISALFGITVAQVRDFFVTQKTRVRK 118
                     799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.32959119IPR001356Homeobox domain
SMARTSM003894.9E-461123IPR001356Homeobox domain
SuperFamilySSF466892.69E-561121IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-462121IPR009057Homeodomain-like
CDDcd000860.0071762119No hitNo description
Gene3DG3DSA:1.20.930.102.6E-5224318IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476767.32E-6227320IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MDEIEIGSSV ESLMELLDSQ KELFHSQIDQ LQDVVVAQCK LTGVNPLAQE MAAGALSIKI  60
GKRPRDLLNP KAAKYLQAVF AVKDAISKRE SREISALFGI TVAQVRDFFV TQKTRVRKQV  120
RLSREKLILP NSDAIRGDGV PENNNATNHV DPVPLNSVHP EACSISWGEG ETVTLMPPED  180
IPPDISDSDK YFVENIFSLL GKEETFSGQV KLMEWIMQIQ DSSVLIWFLS KGGVLILTTW  240
LSQAAAEEQT SVLLLILKVL CHLPLHKASP ENMSAILQSV NGLRFYRTSD ISNRAKGLLS  300
RWTKLFAKIQ AMKKQNRNNS QIDSQSQLLL KQSIAEIMGD TSNPEDILSL TNGRSENVRR  360
IESSQGPKLL LTSADDSTKK HMLGSTPSYN KERRKVQMVE QPGQKAAGKS PQTVRIGTSS  420
RSRPMSADDI QKAKMRALYM QSKNSKKDPL PSAIGDSKTI VPEKPLALQS SKDFPPSQNS  480
EAKTEDTNVP SVEPSAIQPV NGPAIIVPIQ TDEIKKPFLT PSKSISNKVG ILVKMSPQTI  540
LKNCKRIQID WHVPPGMELD EAWRVAAGGN SKEADVQRNR NRRERETTYQ SLQNIPLNPK  600
EPWDREMDYD DSLTLEIPSL QSPEESSTEP QESLDERRTT AGAATTSSSI SCPEPDLELL  660
AALLKNPDLV YALTSGKPSN LAGQDMVKLL DVIKTGAPTS SSSSNKQVEE KVEVSLPSPT  720
PATNPGMSGW GQEAIRNPFS RQNQVGAAVA RSGTHLHVTS MQWKSTNEQA IPRHATAAYN  780
NSVILSHTER QQQQQQQMQP QLHHNHHLQQ QPISTTSYAV REPVGQMGTA TSSGSWRSQQ  840
SQNSYYSHQG NEIALASQAS SYQGNNQQYM SSNREYESWS PDHSPSRNHP NVRGQQQQQQ  900
QQQQQPSRKY DSSSHPYWNQ NKRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429826.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
RefseqXP_010429834.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLD7M3G50.0D7M3G5_ARALL; Putative uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein